PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2224_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family HB-other
Protein Properties Length: 1642aa    MW: 184475 Da    PI: 5.0796
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2224_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74.1e-182379157
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                ++kR   t+ ql++Le+ ++ ++yps++ r++L+ +l+L++rq ++WF+ rR k++k
  RrC2224_p1 23 KSKRKMKTAAQLQVLENTYKAEPYPSEALRADLSVQLNLSDRQLQMWFCHRRLKDRK 79
                679****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-17679IPR009057Homeodomain-like
SuperFamilySSF466891.58E-151680IPR009057Homeodomain-like
PROSITE profilePS5007116.6012080IPR001356Homeobox domain
SMARTSM003892.1E-162284IPR001356Homeobox domain
PfamPF000469.6E-162379IPR001356Homeobox domain
CDDcd000867.83E-142381No hitNo description
PROSITE profilePS5082716.574536595IPR018501DDT domain
SMARTSM005713.7E-23536595IPR018501DDT domain
PfamPF027911.5E-16537592IPR018501DDT domain
PfamPF050661.7E-15718785IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156124.9E-7907945IPR028942WHIM1 domain
PfamPF156137.7E-1310541127IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1642 aa     Download sequence    Send to blast
MEDLSEADKN KTPEGGGAAT ESKSKRKMKT AAQLQVLENT YKAEPYPSEA LRADLSVQLN  60
LSDRQLQMWF CHRRLKDRKS STPAKRQRKD STTPSAAESS KQATAVAATV NAADLVAGNE  120
HNSFPPHELD SRRTGGGGVT VVRRFNEPSP SEVRAIGYVE AQLGERLRDD GPILGMEFDP  180
LPPGAFGTPI EMPSHHRKAA TRPAYETNLY DSVRTIREYQ FLPEQPSSRT DHSERASPAS  240
HHYGVPLDAS SVVMRASSVS GGHHRDDYKS PPQMIPNLNL SAHQVKPGHV SSHHLGEYDS  300
TYQKSYVDPA LHGNEDPFVK SERELGNDND EEDDDGDDGD DVLLQLERKR KSEEARISRE  360
VEAHEKKIRK ELERQDMLRR KREEQIRKEM ERQDRERRKE EERLLRERQR EEERYHKEQM  420
KEMQRREKFL KKETLRAEKM RQKEEMRRVK EVARLKAANE RAMARKIAKE SMELIEDERL  480
ELMEVAALAQ GLPSMLALDF ETLQNLDAYR DKQVTFPPTS VNLKKPFAVK PWNGSDENIA  540
NLLMVWRFLI NFADVLGLWP FTLDEFTQAF HDHDPRLMGE IHIVLLKTII KDIEGVARTL  600
SVCVGANQNA AANPGGGHPH VVEGAYAWGF DIRSWRKNLN VFTWPEILRQ LALSAGLGPE  660
LKKQDIKTMS VHEENEANNS ENVIFNLRVG AAAENAFAKM QERGLSNPRR SRHRLTPGTV  720
KFAAFHVLSI EGEKGLTILE VAEKIQKSGL RDLTTSRTPE ASVAAALSRD TKLFERVAPS  780
TYCVRPSYRK DAGDAETIFA EARERIRMFK SGVTDVDEEA EREEDSESDV GDDPEVDLNL  840
KKEDPDALEI GTLTGGVEPS LENGKLETEP TTSLPEDTKD DIIPDQSLED AVANDGDSAG  900
FDVSKLGEQW VQGLVEGDYS NLSIEERLNA LVALIGIAIE GNTIRISLEE RLEVASALKK  960
QMWSEVQLDK RWKEESLIRA NYLSYPTPKL GIQESPSADV TPISSQDPLQ LQENVSGTET  1020
LQYQQQSYTA DRERLRAELK AYVGYKAEEL YVYRSLPLGQ DRRRNRYWRF SASASRNDPG  1080
CGRIFVELQD GRWRLIDSEE GFDCLVKSLD VRGVRESHLH FMLLKIKASF KEAVRKNVDT  1140
ELCSISTGVD LDSDTAEISS TFKIELGDGD GSGVLQRFQS FERWMWDNML HPGALSAFKH  1200
GAKKSIPLFH ICRSCAELHF AGDVCCPGCG QMMPGGLDVS ELCFADQVAQ LGEILRRDAG  1260
FILRGSNLSP LRIRLLKIQL ALVEASLPPE GLQTHWTESL RKTWGLKLLS SSSPEELHQV  1320
LTMLEVAVKR DFLSSNFETT CELLDLSEEA VVRDVKVLPW IPKTTGGVAL RLFELDSSIA  1380
YTPDQNKDPQ KDKESEDFVG LETNFVRNVQ EEQDVIEATP VQVAYAQEDT EPGLVRGRPQ  1440
RGRGRPRSQR GKKPSQASGG RPPRGASNSN GEPMLRPRAQ PRGGRKKGRR SSGTRTRPTK  1500
GTLGISNEVV VVGRRGKEVA KTALHDWVET PEDEGEASSS GRSFHYDDDD VMAPVDDFGE  1560
TSKLVGRGEF SLHSDDEYEE EEEDMDTKMN VDDEDEDYIN EDSDGGREQP AEMISMDAAA  1620
AARRRFPFED PDLTSSSSSD FQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052396e-76AB005239.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MLN1.
GenBankCP0026886e-76CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597849.10.0PREDICTED: uncharacterized protein LOC106305959
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A0D3D8V30.0A0A0D3D8V3_BRAOL; Uncharacterized protein
STRINGBra033725.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96012530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator